Hello world program in esoteric languages (N-S)

From Esolang
Jump to navigation Jump to search
For more Hello World programs, see the index at Hello world program in esoteric languages.

This page is a continuation of the list of Hello, world! programs in various esoteric programming languages.

naz

9a8m1o
9a9a9a2a1o
7a2o
3a1o
3d7a1o
9s3s1o
8a2m7a1o
9a9a6a1o
3a1o
6s1o
8s1o
3d1o

Without newlines:

9a8m1o9a9a9a2a1o7a2o3a1o3d7a1o9s3s1o8a2m7a1o9a9a6a1o3a1o6s1o8s1o3d1o

NDBall

using only 83 instructions and 20 dimentions

(0) >0
{0,1} >0
{0,2} +
{0,3} Y[72,>1,>0]
{0,3|1,1} <0
{0,1|1,1} <1
{0,4} >2
{0,4|2,1} <0
{0,3|2,1} p
{2,1} >2
{2,2} +
{2,3} Y[101,>3,>2]
{2,3|3,1} <2
{2,1|3,1} <3
{2,4} >4
{2,4|4,1} <2
{2,3|4,1} p
{4,1} >4
{4,2} +
{4,3} Y[108,>5,>4]
{4,3|5,1} <4
{4,1|5,1} <5
{4,4} >6
{4,4|6,1} <4
{4,3|6,1} p
{4,2|6,1} p
{6,1} >6
{6,2} +
{6,3} Y[111,>7,>6]
{6,3|7,1} <6
{6,1|7,1} <7
{6,4} >8
{6,4|8,1} <6
{6,3|8,1} p
{8,1} >8
{8,2} -
{8,3} Y[33,>8,>9]
{8,3|9,1} <8
{8,1|9,1} <9
{8,4} >10
{8,4|10,1} <8
{8,3|10,1} p
{10,1} >10
{10,2} +
{10,3} Y[119,>11,>10]
{10,3|11,1} <10
{10,1|11,1} <11
{10,4} >12
{10,4|12,1} <10
{10,3|12,1} p
{12,1} >12
{12,2} -
{12,3} Y[112,>12,>13]
{12,3|13,1} <12
{12,1|13,1} <13
{12,4} >14
{12,4|14,1} <12
{12,3|14,1} p
{14,1} >14
{14,2} +
{14,3} Y[114,>15,>14]
{14,3|15,1} <14
{14,1|15,1} <15
{14,4} >16
{14,4|16,1} <14
{14,3|16,1} p
{16,1} >16
{16,2} -
{16,3} Y[109,>16,>17]
{16,3|17,1} <16
{16,1|17,1} <17
{16,4} >18
{16,4|18,1} <16
{16,3|18,1} p
{18,1} >18
{18,2} -
{18,3} Y[101,>18,>19]
{18,3|19,1} <18
{18,1|19,1} <19
{18,4} >20
{18,4|20,1} <18
{18,3|20,1} p
{18,2|20,1} E

Never Gonna Fuck You Up

Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
We are no strangers to love
Never gonna run around and desert you
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
We are no strangers to love
Never gonna run around and desert you
Never gonna give you up
Never gonna give you up
Never gonna run around and desert you
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna run around and desert you
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna run around and desert you
Never gonna give you up
Never gonna make you cry
Never gonna make you cry
Never gonna make you cry
Never gonna make you cry
Never gonna let you down
You know the rules and so do I (do I)
Never gonna run around and desert you
Never gonna give you up
Never gonna run around and desert you
Never gonna give you up
Never gonna run around and desert you
Never gonna let you down
Never gonna run around and desert you
Never gonna run around and desert you
Never gonna give you up
We are no strangers to love
Never gonna make you cry
You know the rules and so do I (do I)
Never gonna make you cry
Never gonna let you down
You know the rules and so do I (do I)
Never gonna run around and desert you
Never gonna run around and desert you
Never gonna say goodbye
Never gonna run around and desert you
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna say goodbye
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna say goodbye
Never gonna say goodbye
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna say goodbye
Never gonna run around and desert you
Never gonna run around and desert you
Never gonna say goodbye
Never gonna make you cry
Never gonna let you down
Never gonna say goodbye
Never gonna make you cry
Never gonna say goodbye
Never gonna give you up
Never gonna give you up
Never gonna give you up
Never gonna say goodbye
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna say goodbye
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna let you down
Never gonna say goodbye
Never gonna run around and desert you
Never gonna run around and desert you
Never gonna give you up
Never gonna say goodbye
Never gonna run around and desert you
Never gonna give you up
Never gonna give you up
Never gonna say goodbye

Nice

No Literals, Gotos Only, Final Destination!

\,1
1+1,2
2+1,3
3+1,4
4+1,5
5+1,6
6+2,8

8+1,9
9+1,A
A+1,B
B+2,D

D+1,E
E+1,F
F+1,G
G+10
0,0

0,0
5D
5D
15,b
55
5G
26
60





0:D9*0+4B
0:D9*0+18

3F








0:D9*0+1D



























0:D9*0+56














0:D9*0+5G












0:D9*0+1E
0:D9*0+11,a






0:D9*0+a+1,a


0:D9*0+b+1,b


0:D9*0+5D

NONE

+x----^pc+vp+v++++pp++++++p_+v++++++^p-v------p++++++p-v--pc+v--ps(++++)

NULL-NONE NOTHING (NULL-NONE-BF version)

NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NONE-NONE-NULL
NULL-NONE-NONE NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NONE-NONE-NULL NULL-NONE-NONE NULL-NULL-NULL NULL-NULL-NULL NULL-NONE-NONE NULL-NULL-NULL NULL-NULL-NULL
NULL-NULL-NULL NULL-NONE-NONE NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NONE-NONE NULL-NULL-NULL NULL-NONE-NULL NULL-NONE-NULL NULL-NONE-NULL NULL-NONE-NULL NULL-NULL-NONE
NONE-NONE-NONE NULL-NONE-NONE NULL-NULL-NULL NULL-NONE-NONE NULL-NULL-NULL NULL-NONE-NONE NULL-NULL-NONE NULL-NONE-NONE NULL-NONE-NONE NULL-NULL-NULL NONE-NONE-NULL NULL-NONE-NULL
NONE-NONE-NONE NULL-NONE-NULL NULL-NULL-NONE NONE-NONE-NONE NULL-NONE-NONE NULL-NONE-NONE NONE-NULL-NULL NULL-NONE-NONE NULL-NULL-NONE NULL-NULL-NONE NULL-NULL-NONE NONE-NULL-NULL
NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NONE-NULL-NULL NONE-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL
NONE-NULL-NULL NULL-NONE-NONE NULL-NONE-NONE NONE-NULL-NULL NULL-NONE-NULL NULL-NULL-NONE NONE-NULL-NULL NULL-NONE-NULL NONE-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL NULL-NULL-NULL
NONE-NULL-NULL NULL-NULL-NONE NULL-NULL-NONE NULL-NULL-NONE NULL-NULL-NONE NULL-NULL-NONE NULL-NULL-NONE NONE-NULL-NULL NULL-NULL-NONE NULL-NULL-NONE NULL-NULL-NONE NULL-NULL-NONE
NULL-NULL-NONE NULL-NULL-NONE NULL-NULL-NONE NULL-NULL-NONE NONE-NULL-NULL NULL-NONE-NONE NULL-NONE-NONE NULL-NULL-NULL NONE-NULL-NULL NULL-NONE-NONE NULL-NULL-NULL NULL-NULL-NULL NONE-NULL-NULL

NOR

Because of its tediousness, I only go to print "Hello" in ascii

1
0 REM store the H in line values
 10 NOR 0, 1
 20 NOR 0, 0
 30 NOR 0, 1
 40 NOR 0, 1
 50 NOR 0, 0
 60 NOR 0, 1
 70 NOR 0, 1
 80 NOR 0, 1
90 REM print it all out
 100 OUT #10:0
 110 OUT #20:0
 120 OUT #30:0
 130 OUT #40:0
 140 OUT #50:0
 150 OUT #60:0
 160 OUT #70:0
 170 OUT #80:0
 175 OLN
180 REM Change to little e
 190 NOR #30:0, 0
 200 NOR #50:0, 0
 210 NOR #60:0, 0
 230 NOR #80:0, 0
240 REM Output with replaced values
 250 OUT #10:0
 260 OUT #20:0
 270 OUT #190:0
 280 OUT #40:0
 290 OUT #200:0
 300 OUT #210:0
 310 OUT #70:0
 320 OUT #230:0
 325 OLN
330 REM Change to little l
 340 NOR #200:0, 0
 350 NOR #230:0, 0
 360 REM Output little l twice
 370 OUT #10:0
 380 OUT #20:0
 390 OUT #190:0
 400 OUT #40:0
 410 OUT #340:0
 420 OUT #210:0
 430 OUT #70:0
 440 OUT #350:0
 445 OLN
 450 OUT #10:0
 460 OUT #20:0
 470 OUT #190:0
 480 OUT #40:0
 490 OUT #340:0
 500 OUT #210:0
 510 OUT #70:0
 520 OUT #350:0
 525 OLN
530 REM Change to little o
 540 NOR #70:0, 0
 550 NOR #350:0, 0
560 REM Output little o
 570 OUT #10:0
 580 OUT #20:0
 590 OUT #190:0
 600 OUT #40:0
 610 OUT #340:0
 620 OUT #210:0
 630 OUT #540:0
 640 OUT #550:0
 645 OLN
650 REM Pause at end
 660 INP in0

NOTE

.print/"Hello, world!"\

Novice

a
a-Hello, world!_*
Hello, world!_*

Nqubl

"!dlrow ,olleH"ex

Numberix

A0000159006CA9006C590057A9006F590064A90021000000000000000000000000000000000000
59004809006559006F09002059007209006CFF0000

NyaScript

NyA NyA NyA NyA NyA NyA NyA NyA NyA NyA NYa 
Nya NyA NyA NyA NyA NyA NyA NyA Nya NyA NyA 
NyA NyA NyA NyA NyA NyA NyA NyA Nya NyA NyA 
NyA NyA Nya NyA NyA NyA Nya NyA NyA NyA NyA 
NyA NyA NyA NyA NyA Nya NyA NyA NyA NyA NyA
NyA nyA nyA nyA nyA nyA nyA nYa nYA Nya NyA 
NyA NYA Nya NyA NYA NyA NyA NyA NyA NyA NyA 
NyA NYA NYA nyan NyA NyA NyA NYA Nya NyA NyA 
NyA NyA NYA Nya NyA NyA NYA Nya nYa nYa nYa 
NYA NYAN NyA NyA NyA NYA NyA NyA NyA NYA NYAN
NYA nYa nYa nYa nYa nYa nYa nYa nYa NYA nyA
NyA NYA

or

UwU

$h "Hello,\^^World!"
#h NYA

Obfuscated

0OO00O0O000O00OO00OOOOO00O00O0OO0O0O0OO0000OO0O0OO0O00OOO0OO0O0O0OO000O0O0OO0O0O00OOOO00OOOO00OOO00OO0O00OO0O0OOO0OO00OOO0O0OOOO00OOOO0O0O000OO0O0OO00OOOOOO0OO000OO0000O0O0OOOO00O000O0O0OO00OO00OOO0OO0O0O00OO00O0O00O0O000OO00OO0O0OO0O0000O00O00OO000O0OO0O0OOOOO0O0OOOO0O000O0O00OOOO0OO000O0OOOOOOOO0000OOO00OOO00OOOOO00OOO0O0OOOOOO00OO0O00O0O00OO00O0OO0OOOOO0O00O0O0OO0O0O0OO000O00OOOOO0O00O0OO0OO00O000OO00OO0O00OOO0O000OO0O00OO0O00OO0O00O0O00OOOO0OO0O0OO000OOO0OO0O00O000OO0O00O0O0OOO0OO0OO00O00OO0OO0OOO00OOOOOO0000OOOO000OO00OO00O0OOOO0OO00O00OO0O00O000OO00OO0OO0O00000OOO00OO0O000O00O00O000OOO0OO0OO000O0OO00OOOOO00OOOO00O000OO0OOOOO0O00O0O00O0O0O0OO000OO00OO0OO00OO0OO0O00OO0O00OOOO0O000OO0OO0OO0000OOOOO0O00O0O0O00O0O00OOOO0OO00OOO0000O0O0OO0OO00OO0OOOO00OO00O0OO0OO0O00O00OOO0O00O0O00OO0OOOO00OO00OO00OO0O0OO0O0O00O000OO0OOOOOO00OO0OO00OOOO000OO0O00O00OO0O00O0O0O0OO0OOO0O00O00OO00OO000OO0OO00O0O000O00OO00OOOOO00O00O0OO0O0O0OO000O00OO000OO000OO0000OOO00O000O00O00OO00OO00OO00OOOO000O00OO00O00OO00O0O0O0OOOOOOO0O00OO000O0O00O00OO0O0OO0OOO00OOO00OO00OOO00O0OO0O00OOOO0O00O0O0OO00O0O0OOOO00O00O00OO00OO000O00OO00OOOO0OO00O000OOOO0O0OO0O00OOOOO0OO00OO00O000O000O0OOOO0OOO0O0OOOOOO00OO0OOOO0000OOO00OOO00OOOOO00OOO0O0OOOOOO00OO0O00O0O00OO00O0O00OO00O0O00O0O0OO0O0O00O000O0O0OO0O0O0OO0O00O0O0OO0O00OOOOO000OOO00OOO0OO0O0O0OO000OOO00O0O0O00000O0O0OOO000O00O00O00OO000O0OO0O0OO0O000O000OO0O00O000O0O0OO0O0OO0O00OOOO0OOOOOOO0000O0OO0O0O000OO0OO0OO00O0O0O000OO0O0O0OOO000OO0O000O0O00OOO00O000OOO0OO0OO000O0OO00OOOOO00OOOO00O000OO0OOOOO0O0000O00O0O00OOO000O00O00OO00OOOOO00000OO000OO0O000OOOOO00OOOOO00OOOOO0O0OO0O0OOOOO00OOO00O0OOOOOO0OO0OOO00OOOOO0000O0OO0OO0OO0O00O0O0OOOOOO0OOO0OO000OOO00O0OOO000O00O0O0O000OO0O00OOO0000OO0O000O0O000O0OO00O0O000OO0OOOO000OOO0000OO0O00O0OO0OOOOO00O00OO000OO0OO00O0O000O00OO00OOOOO00O00O0OO0O0O0OO000OO00OO0O00OOO0O0OO0O0O00O000OOO0OOO0OO00OO0O0O0OO0OO0OOOOO0O000OOO0O00O0OO0O0O00O000O00O00OOOO000O0OO0O0OOO00O00OOOO0000OO00OOOO00O00OOO00OOO00OOOOOOO0O0OO0O0OO0OO0OO0O0OO0000O0O00O0O00000OO00O0OOOO000O0OOOO00OOO0OO000OO0OOOOOOO000OO00OO0O0OO0O0OO0OOOOOOOO0000OOO00OOO00OOOOO00OOO0O0OOOOOO00OO0O00O0O00OO00O0O00OO00O0O00O0O0OO0O0O000OO0OOO00O0OOO0O000OO0O0OOOO0OO0OO0O0000OO0000O00000OOO0O0OOOO00OOOO00OOOO0OO0OO0OOO0O00OO0O000O00O0000O0O0OOO0O0000O000OOOO00O000OO0O000O000OO0OO0OO00O000O0OO0000OOO0OO0000OO00000OO000O0OO00O0OO00O00OO00O0OO00O00OO00O000OOO0OO0OO000O0OO00OOOOO00OOOO00O000OO0OOOOO0O00O0O00O0O00OO00O00O0OOOOOO00OO0OO0O00OO0O00OOOO0O000O000OO00O0O0OOO000OOOO000O0OOOO0OOOO0O0OOOO00000OOO00OOOOOOO000OO00O00O0O00OOOOOO000OO0OO0O0OO0O0OO000OO0OOOO0000OO000O0OO00O0O00OOO0O00OOOOOOO0OOO0OO0O00OOO00OOO0OO0O0OOO0000OO0O00OOO00OOOOO0OOOOOO000OO0OO00O0O000O00OO00OOOOO00O00O0OO0O0O0OO000O00OO000OO000OO0000OOO00O000O00O00OO0OO0O00OO0O0OO00OO00O000O00OOO0O0OOO00O00O0OO000O000OOOOOO000OO0O0OO0O0O00OOO00O00OO0O00000O0O0OOOOO0000O0O0O00OOO00O0O00000OO000OOOOO00O0OOOOO000OO000OOOOO0000OO000O0OOO000OOO00OOOO00OO00OOO00O00OO000OO00000OOO00OO0OOOO0000OOO00OOO00OOOOO00OOO0O0OOOOOO00OO0O00O0O00OO00O0OO0OOOO0OO000OO0OO0O0O00OO00OOO0OO0OO0OO0OO00O0O0OO0OO0O0O0OOOOOO00OO0OO000OOO00OOO0O00OOOOO0O0OO0O0O0OOOOOO0OO0O0O0OOOOOO0OO0OO00OOOO000OO0O00O0O0OO00OO0OOO000OO0OO0000OO0O00O000O00OOOO00OO00O0OOO000O00O0O00O0OO00OOOOO00O00OOO000O0OOO000O00O000OOO0OO0OO000O0OO00OOOOO00OOOO00O000OO0OOOOO0O0000O00O0O0O0O00OOOO0OOOOO00OOO00OO00O0O000OOO0OO0O0OO0O0000OO0O00OO00O0OO0OO0O00O000O0O0OO00O00OOO000O0O00O00OOO000O0O0OO0OOO00OOO00O00OO00O0O0OO000OOO000O00OO0OO00O0OO0O0O0000OOO00000OOOO000OOOO0OOOO0OO0O0OO0O0OOO00O0O0OOO0O00OO00O00O00000OO0O0OOO0OOOO0O

ObjLang

e9oFcHJpbnRbAQAAAPoNSGVsbG8sIFdvcmxkITA=

Unmarshalled form:

{"print":["Hello, World!"]}

OISCalypse with I/O

72 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 101 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 108 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 108 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 32 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 87 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 114 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 108 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 33 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.2 0 

Omgrofl

lol iz 72
rofl lol
lol iz 101
rofl lol
lol iz 108
rofl lol
rofl lol
lool iz 111
rofl lool
loool iz 44
rofl loool
loool iz 32
rofl loool
loool iz 87
rofl loool
rofl lool
lool iz 114
rofl lool
rofl lol
lol iz 100
rofl lol
lol iz 33
rofl lol

ONE WAY

push "Hello, world!
print

Ook!

Ook. Ook? Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook.
Ook. Ook. Ook. Ook. Ook! Ook? Ook? Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook.
Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook? Ook! Ook! Ook? Ook! Ook? Ook.
Ook! Ook. Ook. Ook? Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook.
Ook. Ook. Ook! Ook? Ook? Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook?
Ook! Ook! Ook? Ook! Ook? Ook. Ook. Ook. Ook! Ook. Ook. Ook. Ook. Ook. Ook. Ook.
Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook! Ook. Ook! Ook. Ook. Ook. Ook. Ook.
Ook. Ook. Ook! Ook. Ook. Ook? Ook. Ook? Ook. Ook? Ook. Ook. Ook. Ook. Ook. Ook.
Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook! Ook? Ook? Ook. Ook. Ook.
Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook? Ook! Ook! Ook? Ook! Ook? Ook. Ook! Ook.
Ook. Ook? Ook. Ook? Ook. Ook? Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook.
Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook! Ook? Ook? Ook. Ook. Ook.
Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook. Ook.
Ook. Ook? Ook! Ook! Ook? Ook! Ook? Ook. Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook.
Ook? Ook. Ook? Ook. Ook? Ook. Ook? Ook. Ook! Ook. Ook. Ook. Ook. Ook. Ook. Ook.
Ook! Ook. Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook.
Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook! Ook!
Ook! Ook. Ook. Ook? Ook. Ook? Ook. Ook. Ook! Ook.

OOLANG

Hello, World!.println;

Op

o"Hello, World!"

Which also works in Opf.

Orca

Cb............
1bTHello.World

ORK

When this program starts:
There is a scribe called Writer.
Writer is to write "Hello, world!"

Ouroboros

Straightforward version:

"Hello, World!"ooooooooooooo1(

Shorter version:

S"Hello, World!"1(
ewSoL!(

Output

Output "Hello World!"

Which also works in OutputF.

Packlang

Package : IO {
  Integer main {
    charPut(72);
    charPut(101);
    charPut(108);
    charPut(108);
    charPut(111);
    charPut(44);
    charPut(32);
    charPut(87);
    charPut(111);
    charPut(114);
    charPut(108);
    charPut(100);
    charPut(33);
    charPut(13);
    charPut(10);
    0;
  }
} helloWorld;

Paintfuck

*s*s*s*s*enn*enn*s*s*s*s*ee*n*n*n*n*e*e*ssw
*ss*e*ee*e*e*wwn*n*n*n*eeee*s*s*s*s*e*e*een
*n*n*en*es*s*s*sw*eee*sw*wwwwwn[ww]seess*s*
s*s*se*e*n*n*n*n*ee*s*s*s*sw*eeee*wn*n*n*ne
*es*s*s*ees*n*n*n*n*e*es*ws*es*s*ee*n*n*n*n
*[s]ne*e*ee*n*n*n*n*e*es*s*s*sw*eee*nn*n*n*

Look into the memory grid.

Pair

main = const "Hello, World!"

Pairpointing

H = 0, 0, 0, 1, 0, 0, 1, 0, ;
e = 1, 0, 1, 0, 0, 1, 1, 0, ;
l = 0, 0, 1, 1, 0, 1, 1, 0, ;
o = 1, 1, 1, 1, 0, 1, 1, 0, ;
c = 0, 0, 1, 1, 0, 1, 0, 0, ;
s = 0, 0, 0, 0, 0, 1, 0, 0, ;
w = 1, 1, 1, 0, 1, 1, 1, 0, ;
r = 0, 1, 0, 0, 1, 1, 1, 0, ;
d = 0, 0, 1, 0, 0, 1, 1, 0, ;
x = 1, 0, 0, 0, 0, 1, 0, 0, ;
output H,e,l,l,o,c,s,w,o,r,l,d,x,;

Parity

72
101
108
108
111
32
87
111
114
108
100
33
10

(the 72 will increment position 36,inducing an IndexError to terminate the program)

PATH

\/\   /\          /\  /\ 
+++   ++          ++  ++
+++   ++  /++++\  ++  ++  /++++\ 
++\++\++  +    +  ++  ++  +    +
++   +++  +/+++/  ++  ++  +    +
++   +++  ++      ++  ++  +    +
\/   \/\  /\+++   /\  /\  /++.+/  
                          \        \ 
/++++.+++++++++++++++++++++++++++  /  \ 
                          /\       -  -#
                          ++       .  -.
+      /  \++++\  /++++\  ++  /---\-  -+
+  /\  +  +    +  +    +  +.  -   .-  -}
+  +.  +  +    +  +       +-  -   +-  
.  +}  +  +    +  +       +-  -   +-  -.
\.+/\++/  \++++/  +       +\  /-.+/-  --
           \      /    \.{/   \    /  \/

Note: change '{' and '}' to '<' and '>' to make this work in SNUSP.

PDA-er

.1001000.
----1100101-
.1100101.
----1101100-
.1101100.
----1101100-
----1101111-
----1100100-
.1101111.
----101100-
----1110010-
.101100.
----100000-
.100000.
----1110111-
.1110111.
----1101111-
.1110010.
----1101100-
.1100100.
----100001-
..100001.
!
.100011.

PHL 1.0

main[
    println(Hello world!);
]

Pi

  3.1415926535897932384226433232725028841271693992751358239749245923072164062
  822089986780348053431120629821483865332223366470908446395535832317223594083
  284831172502841037019385311052596446029489529303219642288009756259134461214
  751482337817834652812009021456285664234613486134553226482133236073603491413
  737242870066363155841744815239239622292545917053643278925902605113301301488
  204625213821429519415316024320522703627595939530921261373219226137931021185
  580744023794627495273518257527348912274384830113491298346743644406563430865
  2133494633522473749030217386093370277033921317659317670238267581846066440

Pieces

                                                                    #      #                                                             #                        #   +                                                +                     #      #                                                                            +                              #
###+++# #+++# #+++# #+++# #+++####+++###+ +###+ +###+ +###+ +###+ +## #+ +## #++###+ +###+ +###+ +###++++###+++# #+++# #+++# #++ +# #+++## #+++###+ +###+ +###+ +## #++ +###+ +###++ +###++###+++# #+++# #+++# #+++# #++ +# #+++# #+++# #+ +## #+ +## #+++##+++###+ +###+ +###+ +###+ +###+++####+++###+ +###+ +###+ +###+ +## #++ +# #+ +## #++ +####+++# #+ +## #+ +## #++ +## #++ +## #++++## #++ +## #++ +## #++ +## #++ +## #+++##+++####
####+++###+++###+++###+++###+++####+++###+++###+++###+++###+++##++++###+++####+++###+++###+++###+++###++++###+++###+++###++####+++###++++###++++###+++###+++###+++####++++###+++###++++##+++###+++###+++###+++###+++###++++##++####++####++####++++#####++###+++###+++###+++###+++###+++###+++####+++###+++###+++###+++###+++####+++###++++####++++####++###+++####++++####++++####++++####++++####++++####++++####++++####++++####++###+++####
###++####++####++####++####++####++++##++++##++++##++++##++++##+++####+++####+++##++++##++++##++++##++++####++####++####++###++++###++++###++++##++++##++++##++++####++++##++++##+++++##+++###++####++####++####++####++++####+++###+++###+++###++++###++###+++##++++##++++##++++##++++##+++####++++##++++##++++##++++##++++###++++###+++####++++####+++###+++####+++####++++####++++####++++####++++####++++####++++####++++#####++###++####
###+++###+++###+++###+++###+++# ##+++###+++###+++###+++###+++###+++# ##+++# ##++###+++###+++###+++###+ ++###+++###+++###+++###+ ++###+ +# ##+ +###+++###+++###+++# ##+ ++###+++###+ ++###++###+++###+++###+++###+++###+ ++###+++###+++###+++# ##+++# ##+++##+++###+++###+++###+++###+++###+++# ##+++###+++###+++###+++###+++####+ ++###+++####++++## #+++###+++# ##+++####++++####++++####+ ++####++++####++++####++++####++++# ##+++##+++# ##
                                #                                     #                                +                         +                                                                                      +                      #                                               #                                  +

Pig

Hello, World!PIGHello, World!

Pit

NOT 1
SND 1
SND 0
SND 0
SND 0
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
SND 2
SND 1
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 0
SND 1
SND 0
SND 0
SND 0
SND 1
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 1
NOT 2
SND 2
SND 1
SND 2
SND 1
SND 2
SND 1
SND 2
SND 1
NOT 2
SND 2
SND 0
OFF 0

Pixiedust

++.*+..+...
++.*++..+.+
++.*++.++..
++.*++.++..
++.*++.++++
++.*+.++..
++.*+.....
++.*+.+.+++
++.*++.++++
++.*+++..+.
++.*++.++..
++.*++..+..
++.*+....+

Or, more excitingly,

+           +               .   *+       ..  +.        ..            .                  .              .          
.
+            +   .*    +   +.    .    +           .+                         *
                   ++.        *   +  +  .  ++     .  .    *                         .              .      .   .       
.*
               +     +.     *  +    + .+         + .   .*                         .                 .   .    . ..
            ++      .  *     ++.    + ++        +  *                 .      .   ..          .              .*
           +     +   .* + .   +     +.              .  .                  .           .   .   .                .
              +           +  .*+           .   .. .     .*                                 .  .  . ..         . .   
.*
+               +.  *      +. +      .        ++          +*
 +         +. *+                       +       .  ++  ++             ..                                 .     ..
            +  +.        * +  +                 + ..   +  .*                         .
          + +        . *            ++        . + +       ..*            .                          ..
+                  +  .  *  ++.                  .+.. .          .    .                    . ...        ..
            +       +   .  *+                ..    . .    +*.         .      .       .         .       .*

Pizza Delivery

21d64d72d57d20d2Cd6Fd6Cd65d48`a`a``a`a`a`a`ddd`aaaa`ddddd`aaaaaa`a`.

Please Porige Hot

1 Please porige hot or cold Hello, World!

Plurple

say "Hello, world!"

PlusOrMinus

++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++-++++++++++++++++++++++++++++++-++++++++-+-++++-++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++-+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++-++++++++++++++++++++++++++++++++++++++++++++++++++++++++-+++++++++++++++++++++++++-++++-+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++-+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++-++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++-

PocketFuck

Enlarged view

{{{2}}}

Actual size

{{{2}}}

Poetic

the proverbial "unconsciousness"

i was already aware
i had understood fully

i saw the devil
i was perfectly still
involuntarily i paused

there said i:
my sheer consciousness
of certain given circumstances
i noticed
it's nothing
     nothing
     nothing any man wouldn't learn

a way of finding these
i know not

nothing common or typical
and yet (somehow)
very little thought
will normally resolve every contradiction

a foolish heart -> an eternal misfortune

Pokébattle

Needs reduction or patching

Trainer 1: Alice
 Togepi
 Emolga
 Talonflame
 Rhyperior
 Abra
 Pikachu
Trainer 2: Bob
 Yveltal
 Raichu
 Oranguru
 Nidoqueen
 Incineroar
 Avalugg 
‌
Battle Start!
Turn 0:
 Alice: Rhyperior Go!
 Bob: Avalugg Go!

Turn 1:
 Rhyperior uses Absorb!
 Avalugg uses Absorb!

Turn 2:
 Rhyperior uses Absorb!
 Avalugg uses Absorb!

Turn 3:
 Alice: That's enough! Go Pikachu!
 Avalugg uses Splash!

Turn 4:
 Pikachu uses Absorb!
 Bob: That's enough! Go Raichu!

Turn 5:
 Alice: That's enough! Go Rhyperior!
 Raichu uses Absorb!

Turn 6:
 Rhyperior uses Splash!
 Bob: That's enough! Go Avalugg!

Turn 7:
 Rhyperior uses Absorb!
 Avalugg uses Absorb!

Turn 8:
 Alice uses Max Potion!
 Avalugg uses Tackle! It's not very effective.

Turn 9:
 Rhyperior uses Flamethrower!
 Avalugg uses Splash!

Turn 10:
 Rhyperior uses Swords Dance!
 Avalugg uses Swords Dance!

Turn 11:
 Rhyperior uses Tackle! It's not very effective.
 Bob uses Max Potion!

Turn 12:
 Rhyperior uses Skill Swap!
 Avalugg uses Swords Dance!

Turn 13:
 Rhyperior uses Swords Dance!
 Avalugg uses Tackle! It's not very effective.

Turn 14:
 Alice uses Hyper Potion!
 Bob: That's enough! Go Raichu!

Turn 15:
 Rhyperior uses Swords Dance!
 Bob uses Super Potion!

Turn 16:
 Alice: That's enough! Go Pikachu!
 Raichu uses Tackle! It's not very effective.

Turn 17:
 Pikachu uses Swords Dance!
 Raichu uses Swords Dance!

Turn 18:
 Alice: That's enough! Go Rhyperior!
 Bob uses Potion!

Turn 19:
 Alice uses Max Potion!
 Bob: That's enough! Go Avalugg!

Turn 20:
 Rhyperior uses Swords Dance!
 Avalugg uses Flamethrower! It's super effective!

Turn 21:
 Rhyperior uses Swords Dance!
 Avalugg uses Tackle! It's not very effective.

Turn 22:
 Alice uses Hyper Potion!
 Avalugg uses Splash!

Turn 23:
 Rhyperior uses Swords Dance!
 Avalugg uses Swords Dance!

Turn 24:
 Rhyperior uses Flamethrower! It's super effective!
 Avalugg uses Swords Dance!

Turn 25:
 Alice: That's enough! Go Abra!
 Bob: That's enough! Go Raichu!

Turn 26:
 Abra uses Splash!
 Raichu uses Swords Dance!

Battle End!
Winner: Alice

Note: Some examples in pages like Argh! and Aheui has a trailing new line in the output. If you really want a trailing new line here in Pokebattle, you can insert this code before the "Battle End!" message:

Turn 27:
 Abra uses Splash!
 Bob: That's enough! Go Yveltal!

Turn 28:
 Abra uses Absorb!
 Yveltal uses Splash!

Turn 29:
 Abra uses Swords Dance!
 Yveltal uses Splash!

Another note: The Pokebattle page did not mention whether you can apply a move to an inactive Pokemon. If yes, the code might be further reduced.

Polynomial

f(x) = x^50 - 752x^49 + 141960856x^48 - 97823530588x^47 + 6924620364389108x^46 - 4341495724143788540x^45 + 138060613405951923767380x^44 - 79197535132424777586735700x^43 + 979470645655071268126749786680x^42 - 513709357652108230631577128358860x^41 + 770486975689768419626951634418461748x^40 - 273098373735611746286126693707899401476x^39 + 72291664762156559225098986515946802509588x^38 - 14676371828550521943557197189472305446692764x^37 + 2471742454496740843240034728256092024085665124x^36 - 357063163931791512794128153482861289523023882820x^35 + 45115851521103966434436591937303467605719233317170x^34 - 5069635951879805027132623517548283799346981648434460x^33 + 511526544745104457693634223308476770566099272565371060x^32 - 46728094385862876640770832231671877988577394475660885100x^31 + 3886421195321910267418249490411801624852449948925639780700x^30 - 295635895529267179921164468879651662866454307976481821361700x^29 + 20633888636784455204085657939750648669099906931549131855360060x^28 - 1324758206148788859378449344375818925652874503976726821800318620x^27 + 78373487486427853675250519103675553581406450490324786426443578960x^26 - 4277231098063905708498485183459770277016249837260045512086373052580x^25 + 215527455786956603087839057660424758386928544182537723602033298390620x^24 - 10026110853984647107902422007895365708427081026500238164561801279215980x^23 + 430739270392505977394209904953365441102532225723377537121532050266775740x^22 - 17069848872478164030368242448759544641115144627455141327323776464849764020x^21 + 623936547617549209386439841779658427511784043378068133194757937607564613452x^20 - 20993646278144108287371096576875982712212020201505201591115504952836958294764x^19 + 649720717047168714688810604703691057371212844616863730695724642230626940206117x^18 - 18454026326119048562742802386720336605855036106533711987860949339189893357832516x^17 + 480018892566368384981391161715990091416104911769766606211141965273638983019962276x^16 - 11414153815128096188736407808171635605448552508496871507135456079041095632029582920x^15 + 247119850164804163572258046131475110258272489534699880387365447880963300945559555680x^14 - 4862888340475792547245763823711545181858124995375533140243229121347892936079946665360x^13 + 86558002997403388455068105800951021320526816961235127777233671733610160673351674179520x^12 - 1386482271878483438155022114100676424860940250972419166903097785395468148849738551671520x^11 + 19959534586392149266660053142048372043141602919486809273490667168324165973826526352280224x^10 - 253920856155736764038716331406024220136995093667781379719894495826380342450009767792895808x^9 + 2887129000992839385500945493765474545949855475497573514091738434731704727401676275341829504x^8 - 28042509855580438356130080622916737041825853230142162026166889394236138282841003530143152512x^7 + 243032092343346343074179476562493169914690027874421758235567822233002208656757155592889900032x^6 - 1676296630217806396090935946022990777465901542969002129717262721145539754562003915533804752640x^5 + 10587973167254746886025389198053813468704398306519586773922038052938514572005258639168462438400x^4 - 43524882144413253508544104946208809101516451661691038559426656724816915089318151748332891328000x^3 + 204551020411993140063611540392697605993557638942587387542307354260755646692402296279038165920000x^2 - 274800267060219615571000061411061421786428150600591471312149973459733252174021048995828038400000x + 1142695050742106476607449533181123418012829436119125708025689288735734639370685118360020240000000

P0pCrn

_P    _0    _p    _!
@o    #o    $o    st
p_    p_    p_    r_
Th    ms    P0    op
is    g_    pC 
is    op    rn
wh    P0    =_
at    pC    He
co    rn    ll
mm          o_
en          wo
ts          rl
lo          d!
ok
li 
ke 
in
P0
pC
rn
!

Outputs "Hello, world!"

Powder

Note that it performs no output.

{
	"Output" :
	{
		"1" : 72,
		"2" : 101,
		"3" : 108,
		"4" : 108,
		"5" : 111,
		"6" : 44,
		"7" : 32,
		"8" : 119,
		"9" : 111,
		"10" : 114,
		"11" : 108,
		"12" : 100
		"13" : 33
	}
}

Prelude

...8+.!v...4+.1+!..v!..vvv...4+.!vvv.....9+.3-!###!..v6-!..vv..v
9+(1-)^#7+(1-)..^7+!^3+!##8+(1-)^###9+1+(1-)..^^^^^3+!..^8-!#1+!

Printscript

print "Hello, world!"

PRG

VAR CHR CHL
VAR CHR CHO
SET CHL SUB POW TEN TWO TEN
SET CHO SUB POW ADD TEN ONE TWO TEN
PUT ARR 
    MUL ADD TEN TWO SIX
    ADD POW TEN TWO ONE
    CHL
    CHL
    CHO
    ADD MUL ADD SIX ONE SIX TWO
    POW TWO SUB SIX ONE
    ADD ADD CHL TEN ONE
    CHO
    SUB MUL ADD TEN TWO TEN SIX
    CHL
    POW TEN TWO
    ADD POW TWO SUB SIX ONE ONE
END

ProgFk

The following is the hex dump of the program

14 11 14 11 11 14 14 11 14 11 41 14 14 11 41 41 11 14 14 11 41 41 11 14 14 11 41 41 41 41 11 41 14 14 11 11
14 11 11 11 14 14 14 11 41 41 41 14 14 11 41 41 41 41 14 14 14 11 14 11 14 14 11 41 41 11 14 14 11 14 11 11
14 11 11 14 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22
22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 27 11 11 11 11 71 11 11 11 17 11 11 11 11 71 11 11
11 17 11 11 11 11 71 11 11 11 17 11 11 11 11 71 11 11 11 17 11 11 11 11 71 11 11 11 17 11 11 11 11 71 11 11
11 17 11 11 11 11 F0

PTotE

Eu U Es Es No V Pt No Db Es Pa Cr

PUBERTY

It is June 12, 2018, 03:02:04 PM. Izu is in his bed, bored. His secret kinks are vore, fatfurs, inflation, growth and kitsunes. 
Then he spots fatfurs. Soon the following sounds become audible. 

fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap yes fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap yes yeah yeah yeah yes yes fap fap fap yes yEAH YeaH 
fAtfURs,hNNg yEAH fap fap inflation,hnng yeah fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap vore,hnng 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap fap yeah fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap vore,hnng fap 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap yeah ugh fap fap fap fap fap
fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap fap fatfurs,hnng yeah fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap fap 
fap fap fap fap fap fap fap fap fap vore,hnng yeah squirt ugh 
growth,hnng kitsunes,fuck yes sigh

PureStack

"Hello, World!"
!~

Purple

aA1aa1oA0bi0b0bb1bbbAiB0 Purple is the awesomest, so why haven't you tried it yet?
!dlroW ,olleH

Pxem

Original Version
File name
Hello, world!.pxe
File content
(arbitrary, can be empty)
Printing newline in end
File name
Hello, world!.pak.-.pxe
File content
(arbitrary, can be empty)
Including no spaces nor symbols other than hyphen(-) and period(.) in file name
File name
Hello.pAa.-Am.-.pworld.pak.-Ab.-.pxe
File content
(arbitrary, can be empty)
In text2pxem.pl notation, with some comments
Hello.p	Prints "Hello"
Aa.-	Makes ' '
Am.-	Makes ','
.p	Prints ", "
world.p	Prints "world"
ak.-	Makes '\n'
Ab.-	Makes '!'
.p	Prints "!\n"
xe

pyhton [sic]

The following program prints "Hello World" in the standard implementation.

6>^5165_~h1'>>6(I()5<11'h?~|8

The following program prints "Hello World!" in the standard implementation.

_$^5165_~h1'>>6((8' h?~)9<>@.h l];0=

Pyth

"Hello, World!

Python but even worse

print("Hello World!")
1/0

Qdeql

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- h
---------- ---------- ---------- ---------- ----------
--*

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- e
---------- ---------- ---------- ---------- ----------
-----*

-\=/-

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- l
---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- l
---------- ---------- ---------- ---------- ----**

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- o
---------- ---------- ---------- ---------- -----*

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- space
---------- ---------- ---------- ---------- ----------
---------- ---------- ----*

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- w
---------- ---------- ---------- -------*

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- o
---------- ---------- ---------- ---------- -----*

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- r
---------- ---------- ---------- ---------- --*

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- l
---------- ---------- ---------- ---------- --------*

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- d
---------- ---------- ---------- ---------- ----------
------*

---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ---------- newline
---------- ---------- ---------- ---------- ----------
---------- ---------- ---------- ---------- ------*

Qugord

~group hello from %2 to %14 also affect hello into "Hello, world!" also each hello into 0 task give 0 to 1 also at 1 join 1 and %1
~publish also split hello

QuineFuck

Hello World!

The program is also a quine.

Quipu

'H
'e
'l
'l
'o
' 
'W
'o
'r
'l
'd
'!
\n
/\

Radixal!!!!

This prints HELL0 W0RLD!\n. O and o are impossible to print, as is small e.

1 3 2 44 15 27 15 4 2 34 15 34 15 4 4 121 15 4 2 8 15
4 4 45 15 121 15 3 4 56 15 1102 15 46 15 3 2 15 15 3 4 5 15

RANDo

In this case, the code is

rrrrrrrrrrnrrrrrrrrrrnrrrrrrrrrrnrrrrrrrrrrndo
rrrrrrrrrrnrrrrrrrrrrnrrrrrrrrrrnrrrnrnanananrnando
rrrrrrrrrrnrrrrrrrrrrnrrrrrrrrrrrrrrrnaaaaaanaaaaaando
rrrrrrrrrrrrrrrrrrrrnrrrrrrrrrrnrrrrrnrrnrndo
rrrrrrrrrrrrrrrrrrrrnrrrrrrrrrrnrrrrrnrrnrndo
ond
rrrrrrrrrrrrrrrrrrrrrrrrrnrrrrrrrrrrnrrrrrnrrrrnrnaananando
rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrnrrrrrnrnrnaanananrnaanananando
rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrnrrrrrrrrrrnrnananrnrnando
rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrnaaaaanaaaaanrnrnando
rrrrrrrrrrrrrrrrrrrrnrrrrrrrnrnrnanananando

RASEL

A"!dlroW ,olleH">:?@,Hj

Recorder

Hello world
#alternitave
"Hello world"
#more alternative
"some text ok (hello world) yay wow" : () = a
a

Recurse

 Main function
$###########v######################################
>..9n_3n{5Av# 'H' = 9*8       # 'w' = (2*8-1)*8-1 #
#vA3_[_A7_A<# 'e' = 'H'+3*8+5 # 'o' = 'W'-8       #
#>_[5n{4A_[v# 'l' = 'e'+7     # 'r' = 'o'+3       #
#vS1{n2[_n4<# 'l'             # 'l' = 'r'-6       #
#>n{1S_8S_3v# 'o' = 'l'+3     # 'd' = 'l'-8       #
#v[_S8_S6_A<# ',' = 5*8+ 4    # '!' = 4*8+1       #
#>4n{1A_[..!# ' ' = 4*8       #                   <
$###########^######################################

 Multiply by 8 (Bidirectional)
n####v#####
>{8}m#m}8{<
n####^#####

 Push on left stack and print (Bidirectional)
_##v###
>{!#!{<
_##^###

 Add (Bidirectional)
A##v###
>}a#a}<
A##^###

 Subtract (Bidirectional)
S##v###
>}s#s}<
S##^###

Remove Line Numbers

1 Hello World!

ResPlicate

 0 72 0 101 0 108 0 108 0 111 0 32 0 87 0 111 0 114 0 108 0 100 0 33 0 10

ReverseFuck

--------]<----]<--<---<---<->>>>+[<-<-<+<<-]>[>+[<<,<+++,-------,,---,<<,>+,>,---,++++++,++++++++,<<-,<--,

Reversible-2D

R2D1:

 >PHOPeOPlOPlOPoOP,OP OPWOPoOPrOPlOPdOP!O¤

Rhokell

(main) = (print 
             (cons (byte (4) (8)) # "H"
             (cons (byte (6) (5)) # "e"
             (cons (byte (6) (C)) # "l"
             (cons (byte (6) (C)) # "l"
             (cons (byte (6) (F)) # "o"
             (cons (byte (2) (C)) # ","
             (cons (byte (2) (0)) # " "
             (cons (byte (7) (7)) # "w"
             (cons (byte (6) (F)) # "o"
             (cons (byte (7) (2)) # "r"
             (cons (byte (6) (C)) # "l"
             (cons (byte (6) (4)) # "d"
             (cons (byte (2) (1)) # "!"
             (cons (byte (0) (A)) # "\n"
                   (nil))))))))))))))));
(print (cons x y)) = (then (output x) (print y));
(then a b) = b;

Rhotor

x/%"Hello, world!\n"

RinGy

'H.'e.'l..'o.',.'!-.'w.'o.'r.'l.'d.'!._++++++++++.q

Roco

co H{cout 72 yi ro}
co e{cout 101 yi ro}
co l{cout 108 yi ro}
co o{cout 111 yi ro}
co spc{cout 32 yi ro}
co w{cout 119 yi ro}
co r{cout 114 yi ro}
co d{cout 100 yi ro}
co excl{cout 33 yi ro}

yi H yi e yi l yi l yi o yi spc
yi w yi o yi r yi l yi d yi excl
ac

ROOP

"Hello, World!"
h

RPG

 spellbook sb = ()
 merchant m = ()
 # We can create a new char for each letter, because we need less than 10
 char h = (72, 0)
 char e = (101, 0)
 char l = (108, 0)
 char o = (111, 0)
 char w = (119, 0)
 char r = (114, 0)
 char d = (100, 0)
 char _ = (32, 0)
 char return = (13, 0)
 h buys sb from m
 e buys sb from m
 l buys sb from m
 o buys sb from m
 w buys sb from m
 r buys sb from m
 d buys sb from m
 _ buys sb from m
 return buys sb from m
 h whispers sb casting speak()
 e whispers sb casting speak()
 l whispers sb casting speak()
 l whispers sb casting speak()
 o whispers sb casting speak()
 _ whispers sb casting speak()
 w whispers sb casting speak()
 o whispers sb casting speak()
 r whispers sb casting speak()
 l whispers sb casting speak()
 d whispers sb casting speak()
 return shouts sb casting speak()

Rrr

rRrRrrRrrRrrRrrRrRrrrRrrRrrrRrrr
RrRrrrrRrrRrrrrRrrrrRrRrrrrRrrRr
rrrrRrrrrrRrRrrrrrRrrRrrrrrrRrrr
rrrRrRrRrrRrrrrrrrRrrrrrrrRrRrrr
rrrRrrRrrrrrrrrRrrrrrrrrRrRrrrrr
RrrRrrrrrrrrrRrrrrrrrrrRrRrrrrrr
rRrrRrrrrrrrrrrRrrrrrrrrrrRrRrrr
rRrrRrrrrrrrrrrrRrrrrrrrrrrrRrRr
rrrrrrrRrrRrrrrrrrrrrrr

RTFM (F^3)

070 08C

Rubic

.ww ( +ww ) ! +ww +ww +ww +ww r -wg ! +oo b -og ! ! +wo' ! b' .wg *oo +oo ! *wg -oo b -og ! b' +oo +oo +oo ! +wg ! l' -wg ! -oo ! .wg *wg r -wg ! .oo +ww !

Sabdt

pr "hello world";

or a more fancy version that demonstrates what the lang can do

0:"dlrow olleh";
wh(0!=""){
  pr 0.r(".$");
  0:0.rdel(".$");
}

this code takes the "dlrow olleh" string and prints it out in reverse

Sacred

() () () () () () () () () () ( )) () () () () () () () )) () () () () () () () () () () )) () () () )) () (( (( (( (( )( ) )) () () ((( )) () ((( () () () () () () () ((( ((( () () () ((( )) () () ((( (( (( () () () () () () () () () () () () () () () ((( )) ((( () () () ((( )( )( )( )( )( )( ((( )( )( )( )( )( )( )( )( ((( )) () ((( )) (((

Shorter version:

)( )( (( )( (( (( () ( () ( (( () )) )( )( )( )) )( )) )( )) )( (( (( (( ) )) ) (( (( )( )( ((( (( () () () () () () ((( (( (( )( ((( ((( (( (( ((( (( () ((( )) )) ((( )) )) ((( (( (( (( ((( () () () ((( )) )) ((( )) )) )( ((( (( (( (( () (((

SADOL

!",212Hello world!

Salt

'Hello, world'

Sansism

           G                                  GGG
>++++++++++>!+++++++!++++++++++!+++!+##!!!!##-G+G
G.+++++++++++++++##!!##.++!.+++..+++++++.+!.++! G
G!.+++.------.--------.!+.!.G                  GG

SAS-8

ADD 8 3
ADD 8 6
OUT 8
ADD 9 0
ADD 9 2
ADD 9 5
ADD 9 6
OUT 9
ADD 10 2
ADD 10 3
ADD 10 5
ADD 10 6
OUT 10
ADD 11 2
ADD 11 3
ADD 11 5
ADD 11 6
OUT 11
ADD 12 0
ADD 12 1
ADD 12 2
ADD 12 3
ADD 12 5
ADD 12 6
OUT 12
ADD 13 2
ADD 13 3
ADD 13 5
OUT 13
ADD 14 5
OUT 14
ADD 15 0
ADD 15 1
ADD 15 2
ADD 15 4
ADD 15 6
OUT 15
ADD 16 0
ADD 16 1
ADD 16 2
ADD 16 3
ADD 16 5
ADD 16 6
OUT 16
ADD 17 1
ADD 17 4
ADD 17 5
ADD 17 6
OUT 17
ADD 18 2
ADD 18 3
ADD 18 5
ADD 18 6
OUT 18
ADD 19 2
ADD 19 5
ADD 19 6
OUT 19
ADD 20 0
ADD 20 5
OUT 20

Sashleyfuck

shhhhhhhh[ahhhhhhhhsl]ahhhhhhhheshhhhh[ahhhhhsl]ahhhhehhhhhhheehhheshhhhhhhhh[alllllllllsl]ahheshhhhhhh[ahhhhhhhsl]ahhhhhheshhhhh[ahhhhhsl]alehhhellllllelllllllleshhhhhhhh[allllllllsl]alllele

Sclipting

丟낆녬닆묬긅덯댦롤긐뤊

Scratch is dumb

The following program is in hex dump, because it is a binary.

00 00 00 00 00 00 00 00 06 05 
00 00 00 00 06 05 00 00 05 00 
00 00 05 00 00 00 05 00 04 04 
04 04 01 07 05 00 05 00 05 01 
05 05 00 06 04 07 04 01 07 05 
05 03 05 01 01 01 03 00 00 00 
00 00 00 00 03 03 00 00 00 03 
05 05 03 04 01 03 04 03 00 00 
00 03 01 01 01 01 01 01 03 01 
01 01 01 01 01 01 01 03 05 05 
00 03 05 00 00 03

SDOTOS

iHfptiefptilofpiiofpti,fpti fptiWfptiofptirfptilfptidfpti!fpt 

Seeker

!chr.@chr:72.$chr.@chr:101.$chr.@chr:108.$chr.@chr:111.$chr.@chr:32.$chr.@chr:119.$chr.@chr:114.$chr.@chr:100.$chr.@chr:33.$chr._

Self-modifying Brainfuck#

Hello World!
----------[++++++++++.>----------]++++++++++

Note: The line feed is MANDATORY

Selt

println Hello,\ World\!

SendStuff

>(Add      72 >(Output) 
>(Add      29 >(Output)
>(Add      7  >(Output) 
              >(Output)
>(Add      3  >(Output)
>(Subtract 67 >(Output)
>(Subtract 12 >(Output) 
>(Add      55 >(Output)
>(Add      24 >(Output)
>(Add      3  >(Output)
>(Subtract 6  >(Output)
>(Subtract 8  >(Output)
>(Subtract 67 >(Output)

Ser2

!print--:#out:--:#c:#n:/wrote--:'@output--:#out: #c:#n:
!print--:#out:eol:     /wrote- :'@output--:#out:&0a:
!wrote--:'@iopair--:#out:#c:#n:/print--:#out:#n:
!wrote- :'@iopair--:#out:#c:   /#out:

!'@run-:#: / print--:#:
--:'H:--:'e:--:'l:--:'l:--:'o:--:',:--:' :
--:'w:--:'o:--:'r:--:'l:--:'d:--:'!:eol:

Setlang

("Hello World!")

Which also works on Setlang++.

SICKBAY

20 PRINT "WORLD!"
10 PRINT "HELLO, ";
20 PRINT "SAILOR"

Simon says brainfuck

Simon says: +++++++++[>++++++++<-]>.>++++++++++
Simon says: [>++++++++++<-]>+.+++++++..+++.>++++
Simon says: [>++++++++<-]>.<<<<+++++++++++++++.>>.+++.------.--------.

Note that all spaces here are MANDATORY

Skibidi Toilet

Toilet "Hello, world!"

Slim

0^@^@^^@^@^^^
^@^^@^^@^@^@^
@^@^^@^@^^@^^
^@^^@^@^^@^^
^@^^@^@^^^^
@^^@^@^^^^^
^@^@^@^@^@^^^
@^@^^@^@^^^^
@^@^^^@^^@^@^
^@^^@^@^^@^^
^@^^@^^@^@^^
^^@^@^^^^@^
@^^^^@^@^@^@^

small s.c.r.i.p.t.

 Hello\, world

SMATINY

1. Swap 1 with 71.
10. Output this block's position.
11. Swap 11 with 150.
32. Output this block's position.
34. Swap 33 with 32.
35. Swap 35 with 118.
36. Swap 36 with 9.
72. Output this block's position.
101. Output this block's position.
102. Swap 101 with 100.
103. Swap 103 with 107.
104. Swap 104 with 32.
108. Output this block's position.
109. Swap 109 with 107.
111. Output this block's position.
112. Swap 112 with 31.
114. Output this block's position.
115. Swap 110 with 117.
116. Swap 116 with 107.
117. Swap 110 with 99.
119. Output this block's position.
120. Swap 120 with 110.

SMITH#

; SMITH# Hello World! program written by zzo38
; This code uses 33 cells. The number 8 command takes the cell
; number as the parameter and output it. Number 0 command stops
; the program. The first cell is cell zero. Even since cell 32 is
; referenced in the data section, I can reference the reference to cell
; 32 for space rather than adding the space into the data section.
8 25 8 26 8 27 8 27 8 28 8 23 8 29 8 28 8 30 8 27 8 31 8 32 0 72 101 108 111 87 114 100 33

SMITHb

12(0 *) * *
"!" "d" "l" "r" "o" "W" 32 "o" "l" "l" "e" "H"

Smurf

"Hello, world!"o

Snowman

("Hello World!"sPvG

SNUSP

   /e+++++++++++++++++++++++++++++.\  
   ./\/\/\  /+++\!>.+++o.l.+++++++l/                  #/?\  
$H!\++++++\ +   \comma.------------ .<w++++++++.\ /?\<!\-/
   /++++++/ +/\                      /.--------o/ \-/!.++++++++++/?\n
 /=\++++++\ +\\!=++++++\             \r+++.l------.d--------.>+.!\-/
 \!\/\/\/\/ \++++++++++/

Modular SNUSP:

      /@@@@++++#               #+++@@\                #-----@@@\n
$@\H.@/e.+++++++l.l.+++o.>>++++.< .<@/w.@\o.+++r.++@\l.@\d.>+.@/.#
  \@@@@=>++++>+++++<<@+++++#       #---@@/!=========/!==/

So is your face.

Hello World!
So is your face.

Sokolang

 ###    
##*##
#@H*#
#####

---

h:10,13,72,101,108,108,111,44,32,119,111,114,108,100,33

---
rwu

Something

ADD 72
CHR 
ZER
ADD 69
CHR 
ZER
ADD 76
CHR 
ZER
ADD 76
CHR 
ZER
ADD 79
CHR 
ZER
ADD 32
CHR 
ZER
ADD 87
CHR 
ZER
ADD 79
CHR 
ZER
ADD 82
CHR 
ZER
ADD 76
CHR 
ZER
ADD 68
CHR 
ZER

Sortle

hello := "hello, " ".!" "" ? ~
world := "(.....),.!" "" ? ", world" ~

SOS

!+!-!!+!-!!!!+!!-!!+!-!+!-!+!!-!+!!-!!!+!!-!+!!-!!!+!!-!+!!!!-!!+!-!!!!!!+!!!-!+!!!-!+!!-!+!!!!-!+!!!-!!+!-!!+!!-!+!!-!!!+!!-!!+!-!!+!-!+!-!

Spaghetti

10[?100]11
9[?108]10
13[?101]2
12[?10]0
4[?111]5
8[?114]9
2[?108]3
11[?33]12
6[?87]7
3[?108]4
1[?48]13
5[?32]6
7[?111]8

SpaghettiScript

[1~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA
⇢~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~:OA] ---≡1 

Spam

I want to tell you a secret, please read line 2.
Print "Hello, World!", please read line 3.
I just want to say, you are fooled.

SPIKE

"Hello, world!"01so¡0_

Spin

START TO SPIN!
SPIN THIS ALL! High end lock likes offering. With old red lamps dodged.
STOP SPINNING!

Spiral

e0v ***   *eXlv**   *lX      *2X       **oXi
v * * *   *     *   * 2      * o      **   v*
* * * *   * *****   * v      * v      * *iX *
* * * *   * *       * ^      v *      * * w *
* *** *   * *****   * v      * *      * * v *
*     *   *     ^   * ^      * *      * * * *
* *** *   * ****v   * v      * *      v * * *
* * * *   * *       * *      * *      ^ * * *
* * * *   * *****   * *****  * *****  * *** *
* * * *   *     *   *     *  *     *  **   **
*** ***   *******   *****v^  *******   *****


*wX ***    **3Xp    *rX4..   d5*      qd**  
* 3 * *   **   v^   *    ..  * *      *  ***
* v * ^   * #pX v   * ..  .  * *      *    **
* *** v   * # r #   * ..  .  * *      * !q* *
* * * *   * # v #   * 54 ..  * *      * * * *
* * * *   * # * #   *   @X   * *      * * * *
* * * *   * # * #   *   v    * *      * * * *
* * * *   * # * #   * * **   * *      * * * *
*  *  *   * # * #   * ** **  * *      * *** *
*  *  *   * #v* ^   * *** *  * *****  *    **
** * **   **   *v   * * * *  *     *  *  ***
 *****     *v^**    *** ***  *******  **** 

Spleenmap

   .++  ...+...+...
 +++ +* .         +
++      ++       +.
.        +       +
.+       + +..+ ++
 ++ +++ .+ +  + +
  +.. + .  + .+ .++
      . ...+ +    +
    ++.      +. ++.
    +         . .
    .+       ++ ++
     +++     +   +++   ?++.
       +     +     +      .
       .     +   ++.     ++
      ++     ++. +  +++  +
      +        . +... ++ +
      .+   ++. .       +..
       +++ + +++
         ++.

Splinter

\H\e\l\l\o\,\ \w\o\r\l\d\!\

Spoon

0101111111110010001111111111010000001101100101001011111110010001111110
1000000110111001010111111100101000101011100101001011111111111001000110
0000000000000000001000000110110000010100000000000000000000000000000000
0000000101001011111111111001000111111101000000110110010100101111110010
0011111101000000110110010101110010100000000000000000000010100000000000
0000000000000000101001011111111111001000110000000000000000000100000011
011000001010

Stack-based

P "Hello World!"

Stackint

Outputs an array of the ASCII values for "Hello World", as that's the only form of output in Stackint.

98*99*54*+99*93*+99*93*+99*65*+84*99*6+99*65*+99*93*+6+99*93*+91+91+*

Stackstack

"Hello, world!" 
print
72 char print 101 char print 108 char dup print print 111 char print "," print " " print
119 char print 111 char print 114 char print 108 char print 100  char print 33 char print

STBF

phrase Hello, World!


Stlisp

"Hello, World!" (print)
"Hello, World!" print ()
print ("Hello, World!")
print "Hello, World!"()
(print "Hello, World!")
("Hello, World!" print)

Strelnokoff

REM HELLO WORLD IN STRELNOKOFF
REM CHRIS PRESSEY MARCH 24 2001
X = (X / X) * X + (X = 0) * (T =  0) * (PRINT CHAR 'H' - 'H' +  1)
X = (X / X) * X + (X = 0) * (T =  1) * (PRINT CHAR 'e' - 'e' +  2)
X = (X / X) * X + (X = 0) * (T =  2) * (PRINT CHAR 'l' - 'l' +  3)
X = (X / X) * X + (X = 0) * (T =  3) * (PRINT CHAR 'l' - 'l' +  4)
X = (X / X) * X + (X = 0) * (T =  4) * (PRINT CHAR 'o' - 'o' +  5)
X = (X / X) * X + (X = 0) * (T =  5) * (PRINT CHAR ',' - ',' +  6)
X = (X / X) * X + (X = 0) * (T =  6) * (PRINT CHAR ' ' - ' ' +  7)
X = (X / X) * X + (X = 0) * (T =  7) * (PRINT CHAR 'w' - 'w' +  8)
X = (X / X) * X + (X = 0) * (T =  8) * (PRINT CHAR 'o' - 'o' +  9)
X = (X / X) * X + (X = 0) * (T =  9) * (PRINT CHAR 'r' - 'r' + 10)
X = (X / X) * X + (X = 0) * (T = 10) * (PRINT CHAR 'l' - 'l' + 11)
X = (X / X) * X + (X = 0) * (T = 11) * (PRINT CHAR 'd' - 'd' + 12)
X = (X / X) * X + (X = 0) * (T = 12) * (PRINT CHAR '!' - '!' + 13)
X = (T = X) * 0 + (X > T) * X REM RESET FLAG
T = (X / X) * X + (X = 0) * T REM INCREMENT TICK

Stroke

|| ||| ||||| ||||||| |||||||||| ||||||||||||| |||||||||||||||
||||||||||||||||||| |||||||||||||||||||| |||||||||||||||||||||
|||||||||||||||||||||| ||||||||||||||||||||||||
||||||||||||||||||||||||| ||||||||||||||||||||||||||
|||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||

Stroke+-

+|+|+|+||+||+||+||+||+||+||+||+||+||+|||+|||+|||+|||+|||+|||+|||+|||+|||+
||||+||||+||||+||||+||||+||||+||||+||||+|||||+|||||+|||||+|||||+|||||+
|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+
|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+|||||+
|||||+||||||+||||||+||||||+||||||+||||||+||||||+||||||+||||||+||||||+||||||
+||||||+||||||+||||||+||||||+||||||+||||||+||||||+||||||+||||||+||||||+
||||||+||||||+||||||+||||||+||||||+||||||+||||||+||||||+||||||+|||||||

Stuck

"Hello, world!"

or


stupidBASIC

program
 say Hello, world!
end program

stupidc

BE6502

Notice: This version requires lcd.sc and via.sc.

system(&BE6502);
include(#"lcd.sc");

reset({
	$lcd.init(:lcd.init.8x10);
	$lcd.print(:hworld);
});

mem(:hworld,#"Hello, world!");

Interpreted

system(&runnow);

reset({
	debug.print(#"Hello, world!");
});

StupidStackLanguage

avqmimcfdddfviiffvddfavdegmfavdmcwfwdddfvddfwdfwdddf

STXTRM

[Hello, world!]

Subleq

############################################
#  FileName:   helloworld.sq
#  Author:     Lawrence Woodman
#  Date:       26th March 2009
#===========================================
#  Outputs 'hello, world'
############################################
loop:       hello (-1)              # Outputs character pointed to by hello
            minusOne loop           # Increments character output pointer to next character
            minusOne checkEnd+1     # Increments end of string pointer to next character
checkEnd:   Z hello (-1)            # Halts program if character at pointer is zero
            Z Z loop                # Jumps to loop
				
# Data Storage				
. minusOne: -1                      # Used to increment pointer
. hello: "hello, world\n" Z: 0      # Zero terminated string to print

Subskin

2
48
18
a
1
2
4
2
a
6
0
100
a
21
64
6c
72
6f
77
20
2c
6f
6c
6c
65

suicide

<*vAA:"Hello, world!"

Super Stack!

0 33 100 108 114 111 87 32 44 111 108 108 101 72
if outputascii fi

Surtic

c0++++++++fc0[c1++++fc1[c1‑c2++c3+++c4+++c5+]c0‑c2+c3+c4‑c6+]oc2c3---oc3c3+++++++oc3oc3c3+++oc3oc5c4‑oc4oc3c3+++oc3c3------oc3fc6[c3-]oc3c5+oc5c6++oc6

SVM

## The hello world program in SVM code
AM =0000000C
CM $Hello World!,=0000000C,*00000000
DD *00000000,=0000000C
IC *00000000
EP

Sword

-|> H
--|========>
--|===>
---|===========>
-|> e
--|==>
--|=>
--|==>
---|===========>
----|===> repeat 2 times
-|> l
--|==>
--|=>
--|=========>
---|===========>
--------|> end
-|> o
--|==>
--|==>
--|==>
---|===========>
-|> ,
--|=====>
--|=====>
---|===========>
-|> space
--|====>
--|===>
---|===========>
-|> W
--|=========>
--|========>
---|===========>
-|> o
--|==>
--|==>
--|==>
---|===========>
-|> r
--|==>
--|==>
--|=====>
---|===========>
-|> l
--|==>
--|=>
--|=========>
---|===========>
-|> d
--|==>
--|=>
--|=>
---|===========>
-|> !
--|====>
--|====>
---|===========>

Swordfish

Hello:, \
,,/#;,,,W
,,\!dlro/

SYCPOL

COMMENT           CARD
STANDARD SYSTEM CARD I

THESE  CARDS  PROVIDED
IN THIS  FILE  ARE THE
IMPLEMENTATION  OF THE
FAMOUS  "HELLO  WORLD"
PROGRAM   IN   SYCPOL.

THE IMPLEMENTATION  OF
THE  "PRINT TO STREAM"
PROCEDURE     FROM THE
STANDARD LIBRARY    IS
INCLUDED FOR THOSE WHO
DON'T HAVE IT ALREADY.

THESE CARDS        ARE
RELEASED  IN SO CALLED
"PUBLIC DOMAIN".



COMMENT           CARD
STANDARD SYSTEM CARD I

A SHORT NOTE ABOUT THE
FORMAT OF THE PROGRAM.

ALL  SPACES   INCLUDED
ARE MANDATORY.

THIS  PROGRAM  DOESN'T
CONTAIN    THE   WHOLE
STANDARD LIBRARY, ONLY
THE  "PRINT TO STREAM"
PROCEDURE.

THIS PROGRAM USES ONLY
DATATYPES "INTEGER 8",
"STRING 8" AND "STRING
16".



PROGRAM           CARD
STANDARD SYSTEM CARD I
DOCUMENTATION DIVISION

IDENTIFIER   STRING 16
"HELLO WORLD"

AUTHOR NAME  STRING 16
"GERMANYBOY"

IMPORTS       DIVISION

!PS EXTERNAL PROCEDURE

MODULE NAME   STRING 8
"STDIO"

IDENTIFIER   STRING 16
"PRINT TO STREAM"

INPUT OUTPUT  DIVISION

PROGRAM           CARD
STANDARD SYSTEM CARD I

OPEN STANDARD OUTPUT
CLOSE STANDARD INPUT

.STDOUT  OUTPUT STREAM
OUTS STANDARD OUTPUT

STORAGE       DIVISION

.TEXT        STRING 16
"HELLO WORLD!"

PROGRAM CODE  DIVISION







PROGRAM           CARD
STANDARD SYSTEM CARD I

MAIN         PROCEDURE
(1) PROCEED TO !PS
      WITH ARGUMENTS
        .TEXT
        .OUTPUT
(2) RETURN
      WITH SUCCESS












PROGRAM           CARD
STANDARD SYSTEM CARD I
DOCUMENTATION DIVISION

IDENTIFIER    STRING 8
"STDIO"

AUTHOR NAME  STRING 16
"GERMANYBOY"

STORAGE       DIVISION

.ZERO        INTEGER 8
0

PROGRAM CODE  DIVISION






PROGRAM           CARD
STANDARD SYSTEM CARD I

!PRINTTS     PROCEDURE

IDENTIFIER   STRING 16
"PRINT TO STREAM"

PARAMETER      SECTION

$TEXT        STRING 32
$STREAM  OUTPUT STREAM

VARIABLE       SECTION

$I           INTEGER 8
0

$L           INTEGER 8
UNDEFINED


PROGRAM           CARD
STANDARD SYSTEM CARD I

PROCEDURE CODE SECTION
(1) CHANGE $L
      TO THE LENGTH
        OF $TEXT
(2) IF $I=$L       (6)
(3) SEND THE CHARACTER
      AT $I
      IN $TEXT
      TO $STREAM
(4) INCREMENT $I
(5) JUMP           (2)
(6) RETURN
      WITH SUCCESS






syncin

"Hello, World!" helloworld def;
helloworld var;
This list is continued at Hello world program in esoteric languages (T-Z).