StupidStackLanguage

From Esolang
Jump to navigation Jump to search
SSL Logo

StupidStackLanguage (or SSL) is an esoteric programming language created by Lebster in which all operations take place on a Stack

SSL Uses the characters A-Z to perform actions. SSL is also case-insensitive.

Operations

Note: Items on the stack can only be numbers.

Character Operation
a Pushes 0 to the top of the stack
b Pops the 1st item from the stack
c Subtracts the 2nd item on the stack from the 1st item and pushes the result to the stack
d Decrements the 1st item of the stack by 1
e Pushes the 1st item mod the 2nd item onto the stack
f Prints the 1st item on the stack as an ASCII character
g Adds the first 2 stack items together and pushes the result to the stack
h Gets input from the user as a number and pushes to the stack
i Increments the 1st item of the stack by 1
j Gets input from the user as a character and pushes that characters ASCII code onto the stack
k Skips the next command if the 1st item on the stack is 0
l Swaps the 1st and 2nd items on the stack
m Multiplies the first two stack items together and pushes the result onto the stack
n If the 1st item on the stack is equal to the 2nd item, push a 1 to the stack, else push a 0
o Pops the (first item on the stack)th item on the stack
p Divides the 1st item on the stack by the 2nd item and pushes the result onto the stack
q Duplicates the 1st item on the stack
r Pushes the total length of the stack onto the stack
s Swaps the 1st and (first item on the stack)th items on the stack
t If the 1st item on the stack is 0, jumps to the corresponding 'u' in the program, otherwise does nothing
u If the 1st item on the stack is not 0, jumps back to the corresponding 't' in the program, otherwise does nothing
v Increments the top item on the stack by 5
w Decrements the top item on the stack by 5
x Prints the 1st item on the stack
y Deletes the entire stack
z Exits the script

Examples

Hello World

aviiiqimfvvvvvvdfvvdddffvddfqwwwwwiavvvvvviifbfbfiiifwdfwwiif

Cat

jf

Truth-machine

htxux

Find the Factorial of a Number

hqdtmldubx
h # Set X
q # Duplicate x (z)
d # Decrement z (y)
t # Begin loop
	m # Multiply y by x
	l # Swap result and y
	d # Decrement y
u # End loop
b # Pop remaining 0
x # Print (x!)

Calculator

hhhtdtdtblpxzubmxzublcxzubgxz

Usage

Takes 3 inputs, X, Y and Z

Z Program output
0 X + Y
1 X - Y
2 X * Y
3 X / Y

Print the Fibonacci Sequence

# Note: Works best on tio.run as when run via command line it runs so fast that you can't really see any of the numbers.
axavvfbaitgxavvfbu

Print a box of any character

jfffavvflflqvvvviifblflflfff

Print any string

I have created a script which can convert any string into an SSL program that will print that string. You can find it on tio.run HERE

Example program created with this script:

# Prints "StupidStackLanguage"
avvvvvvvvvvvvvvvviiifvvvvvviiififwfwddfwfwwwddfvvvvvviiifwwwwifiifviiifwwwwwwdfvvvvifvviiifwddfvvvdfwwwwfvifddf

Implementations

Website

You can use the website to run SSL code online, however due to being programmed in javascript, it's considerably slower than tio.run, which itself is much slower than saving the python interpreter.

Python

Yes, I know this is terrible, but I'm new to python so cut me some slack

import sys, re

f = open(sys.argv[1], "r");
prg = f.read();
f.close();
stack = []
prg = (re.compile('#(?=.*).*',re.IGNORECASE).sub("",prg))
prg = (re.compile('[^abcdefghijklmnopqrstuvwxyz]*', re.IGNORECASE).sub("", prg))
prgPos = 0
shouldSkip = False

while prgPos<len(prg):
    if shouldSkip:
        shouldSkip = False
    else:
        char = prg[prgPos].lower()
        if char == "a":
            stack.insert(0,0)
        elif char == "b":
            stack.pop(0)
        elif char == "c":
            stack.insert(0,stack[0] - stack[1])
        elif char == "d":
            stack[0]-=1
        elif char == "e":
            stack.insert(0,stack[0] % stack[1])
        elif char == "f":
            print(chr(stack[0]),end="")
        elif char == "g":
            stack.insert(0,stack[0] + stack[1])
        elif char == "h":
            stack.insert(0,int(input("\nNumber: ")))
        elif char == "i":
            stack[0]+=1
        elif char == "j":
            stack.insert(0,ord(input("\nInput: ")[0]))
        elif char == "k":
            if stack[0]==0:
                shouldSkip = True
        elif char == "l":
            temp = stack[1]
            stack[1] = stack[0]
            stack[0] = temp
        elif char == "m":
            stack.insert(0,(stack[0] * stack[1]))
        elif char == "n":
            stack.insert(0,int(stack[0]==stack[1]))
        elif char == "o":
            stack.pop(stack[0])
        elif char == "p":
            stack.insert(0,stack[0] / stack[1])
        elif char == "q":
            stack.insert(0,stack[0])
        elif char == "r":
            stack.insert(0,len(stack))
        elif char == "s":
            temp = stack[stack[0]]
            stack[stack[0]] = stack[0]
            stack[0] = temp
        elif char == "t":
            if stack[0] == 0:
                opened = 0
                prgPos += 1
                while prgPos < len(prg):
                    if prg[prgPos] == "u" and opened == 0:
                           break
                    elif prg[prgPos] == "t":
                        opened += 1
                    elif prg[prgPos] == "u":
                        opened -= 1
                    prgPos += 1
        elif char == "u":
            if stack[0] != 0:
                closed = 0
                prgPos -= 1
                while prgPos >= 0:
                    if prg[prgPos] == "t" and closed == 0:
                        break
                    elif prg[prgPos] == "u":
                        closed += 1
                    elif prg[prgPos] == "t":
                        closed -= 1
                    prgPos -= 1
        elif char == "v":
            stack[0]+=5
        elif char == "w":
            stack[0]-=5
        elif char == "x":
            print(stack[0],end="")
        elif char == "y":
            stack = []
        elif char == "z":
            sys.exit(0)
        else:
            print("Invalid character:",char,"at",prgPos);
            sys.exit(0)
    prgPos+=1

Usage

> python SSL.py [SSL SCRIPT]

Online

You can use the interpreter online HERE

Get string from program

THIS JS script can take an SSL program that prints something and can tell you what it would print, however it only works with scripts generated by or following the same rules as HERE


Notes

Comments can be written as such:

# Comment